compare

Comparison List

dhorGFP

dhorGFP is a fluorescent protein published in 2008, derived from Danafungia horrida.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Danafungia horrida 26.0 kDa -

FPbase ID: U7WYN

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

dhorGFP Sequence

MSYSKQGIVQEMKTKYRMEGSVNGHEFTIEGVGTGYPYEGKQMSELVIIKPKGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHNSIFHGVNFPADGPVMKKKTIGWDKSFEKMTVSKEVLTGDVTMFLMLEGGGYHRCQFHSTYKTEKPVELPPNHVVEHQIVRTDLGQSAKGFTVKLEAHAAAHVNPLKVQ
GenBank: ABB17972
UniProtKB: A8CLX9
IPG: 4901548

Excerpts

No excerpts have been added for dhorGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change