compare

Comparison List

d-RFP618

d-RFP618 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Entacmaea quadricolor. It is reported to be a very slowly-maturing dimer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Dimer Entacmaea quadricolor 26.2 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560 618 0.35     480.0  

Photostability

no photostability measurements available ... add one!

d-RFP618 Sequence

d-RFP618 was derived from RFP618 with the following mutations: T122R

MNSLIKENMRMMVVMEGSVNGYQFKCTGEGDGNPYMGTQTMRIKVVEGGPLPFAFDILATSFMYGSKTFIKHTKGIPDFFKQSFPEGFTWERVTRYEDGGVFTVMQDTSLEDGCLVYHAKVRGVNFPSNGAVMQKKTKGWEPSTEMLYPADGGLRGYSQMALNVDGGGYLFCSFETTYRSKKTDENFKMPGFHFVDHRLERLEESDKEMFVVQHEHAVAKFCDLPSKLGRL

Excerpts

No excerpts have been added for d-RFP618
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change