compare

Comparison List

CRISPRed2s

CRISPRed2s is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2021, derived from Entacmaea quadricolor. It has very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Entacmaea quadricolor 26.6 kDa -

FPbase ID: M59JJ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
464 590 28,700 0.382 10.96 2.23 90.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

CRISPRed2s Sequence

BLAST

CRISPRed2s was derived from mCRISPRed with the following mutations: N8Y/R122S/N223D
amino acid numbers relative to eqFP611. show relative to mCRISPRed

MVSKGEELIKEYMRMKVVMEGSVNGHQFKCTGEGEGRPYEGVQTMRIKVIEGGPLPFAFDILATSFMYGSRTFIKYPADIPDFFKQSFPEGFTWERVTRYEDGGVVTVTQDTSLEDGELVYNVKVSGVNFPSNGPVMQKKTKGWEADTEMMYPADGGLRGYLDRALKVDGGGHLHCNFVTTYRSKKTVGDIKMPGVHAVDHRLERIEESDNETYVVQREVAVAKYSDLGGGMDELYK

Excerpts

No excerpts have been added for CRISPRed2s
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

LSSmScarlet, dCyRFP2s, dCyOFP2s and CRISPRed2s, Genetically Encoded Red Fluorescent Proteins with a Large Stokes Shift

Subach Om, Vlaskina Av, Agapova Yk, Dorovatovskii Pv, Nikolaeva Ay, Ivashkina Oi, Popov Vo, Piatkevich Kd, Khrenova Mg, Smirnova Ta, Boyko Km, Subach Fv

(2021). International Journal of Molecular Sciences, 22(23) , 12887. doi: 10.3390/ijms222312887. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change