compare

Comparison List

cpasCP

cpasCP is a fluorescent protein published in 2002, derived from Condylactis passiflora.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Condylactis passiflora 25.4 kDa -

FPbase ID: 8M1M5

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

cpasCP Sequence

MAGLLKESMRIKIYMEGTVNGYHFKCEGEGDGNPYEGTQNMRIRVTEGAPLPFAFDILSPCCAYGSKTFIKHTSGIPDYFKQSFPEGFTWERTTIYEDGGVLTAHQDTSLEGNCLNYKVKVLGTNFPADGPVMKNISGGWEPCTEIVYQDNGVLRGRNVMALKVSGRPPLICHLHSTYRSKKACALTMPGFHFADLRIQMPKKKKDEYFELYEASVARYSDLPEKAN
GenBank: AAL27541
UniProtKB: Q95W11
IPG: 136058

Excerpts

No excerpts have been added for cpasCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change