compare

Comparison List

cpasCP

a.k.a. cpCP

cpasCP is a fluorescent protein published in 2001, derived from Condylactis passiflora.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Condylactis passiflora 25.4 kDa -

FPbase ID: 8M1M5

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
571            

Photostability

No photostability measurements available ... add one!

cpasCP Sequence

MAGLLKESMRIKIYMEGTVNGYHFKCEGEGDGNPYEGTQNMRIRVTEGAPLPFAFDILSPCCAYGSKTFIKHTSGIPDYFKQSFPEGFTWERTTIYEDGGVLTAHQDTSLEGNCLNYKVKVLGTNFPADGPVMKNISGGWEPCTEIVYQDNGVLRGRNVMALKVSGRPPLICHLHSTYRSKKACALTMPGFHFADLRIQMPKKKKDEYFELYEASVARYSDLPEKAN
GenBank: AAL27541
UniProtKB: Q95W11
IPG: 136058

Excerpts

No excerpts have been added for cpasCP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Diversity and evolution of the green fluorescent protein family

    Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

    (2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change