compare

Comparison List

Clomeleon

Clomeleon is a basic (constitutively fluorescent) green fluorescent protein published in 2013, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Aequorea victoria 27.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 535          

Photostability

no photostability measurements available ... add one!

Clomeleon Sequence

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFGYGVTCFARYPDHMRQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKANFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSYQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for Clomeleon
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change