compare

Comparison List

CheGFP1

CheGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2014, derived from Clytia hemisphaerica.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Clytia hemisphaerica 25.6 kDa -

FPbase ID: 63KQB

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 500          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

CheGFP1 Sequence

BLAST
MASAGALLLNQRVPFIMELDAEVNGIRFAVRGKGTGDATTGIIDTKFVCTTGKLPVPWASISSTMAYGALCFAKYPDSVKDFFKSAMPDGYIQEKTISFENDGAYKVRGVITYEHGSIYNRVTLKGEGFKKDGLILQKQYEFCCPNSAVYVLPDKENNGLRVVYNTIYKLKDGGHHLAAHEQQNTPLGGGVVDIPNYHHIHAGSIFSKDLEETRDHMCLVETVRAVNLETYN
GenBank: AEP19814
UniProtKB: J9PGT0
IPG: 24814318

Excerpts

No excerpts have been added for CheGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

An endogenous green fluorescent protein-photoprotein pair in Clytia hemisphaerica eggs shows co-targeting to mitochondria and efficient bioluminescence energy transfer

Fourrage C, Swann K, Gonzalez Garcia Jr, Campbell Ak, Houliston E

(2014). Open Biology, 4(4) , 130206-130206. doi: 10.1098/rsob.130206. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change