compare

Comparison List

cgigGFP

cgigGFP is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2002, derived from Condylactis gigantea.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Condylactis gigantea kDa -

FPbase ID: UHFA9

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
399 496          

Photostability

No photostability measurements available ... add one!

cgigGFP Sequence

MYPWIKETMRSKVYMEGDVNNHAFKCTAVGEGKPYKGSQDLTITVTEGGPLPFAFDILSHAFQYGNKVFTDYPDDIPDFFKQSLSDGFTWRRVSXYXXGGVLTVTQDTSLKGDCIICNIKVHGTNFPENGPVMQNKTDGWEPSSTETVIPQDGGIVAARSPALRLRDKGHLICHMETTYKPNKEVKLPELHFHHLRMEKLSVSDDGKTIKQHEYVVASYSKVPSKIGRQ
GenBank: AAK71342
UniProtKB: Q8T5E7
IPG: 90243

Excerpts

No excerpts have been added for cgigGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Diversity and evolution of the green fluorescent protein family

Labas Ya, Gurskaya Ng, Yanushevich Yg, Fradkov Af, Lukyanov Ka, Lukyanov Sa, Matz Mv

(2002). Proceedings of the National Academy of Sciences, 99(7) , 4256-4261. doi: 10.1073/pnas.062552299. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change