compare

Comparison List

cerFP505

cerFP505 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Cerianthus sp..

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Cerianthus sp. 25.4 kDa -

FPbase ID: 8XMCL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 505 54,000 0.55 29.7   360.0  
Edit States/Attributes

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
420.0   Vogt et al. (2008)
A caution on interpretation of photostability measurements
Add photostability info

cerFP505 Sequence

BLAST
MSQFPEYLPVTVHMRGNVNNLEFEYDGEGGGDPRAGQFTMNMQLRGRKPLPFSYDIITTGFQYGVRAFTKYPDSIADYFKGSFPEAFQWNRRIEFEDGGVINMSSDITFKDNRVYGDVWALGVNFPPNGPVMKNEIVMEEPAEETLIPQNGVLVGFCPKAYLLKDGSYYYGKMTTFYRSKKSGQALPGFHFIQHRLVKTKVEPGFKMVEQSEYATAFVSDLPK
GenBank: ACH67606
UniProtKB: B9UPG6
IPG: 15501371

Excerpts

No excerpts have been added for cerFP505
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

A Green Fluorescent Protein with Photoswitchable Emission from the Deep Sea

Vogt A, D'Angelo C, Oswald F, Denzel A, Mazel Ch, Matz Mv, Ivanchenko S, Nienhaus Gu, Wiedenmann J

(2008). PLoS ONE, 3(11) , e3766. doi: 10.1371/journal.pone.0003766. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change