compare

Comparison List

cerFP505

cerFP505 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Cerianthus sp.. It is reported to be a very slowly-maturing tetramer.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Cerianthus sp. 25.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 505 54,000 0.55 29.7   360.0  

Photostability

t1/2 (s) Power Light Mode In Cell Fusion ˚C Reference
420.0 Vogt et al. (2008)

cerFP505 Sequence

MSQFPEYLPVTVHMRGNVNNLEFEYDGEGGGDPRAGQFTMNMQLRGRKPLPFSYDIITTGFQYGVRAFTKYPDSIADYFKGSFPEAFQWNRRIEFEDGGVINMSSDITFKDNRVYGDVWALGVNFPPNGPVMKNEIVMEEPAEETLIPQNGVLVGFCPKAYLLKDGSYYYGKMTTFYRSKKSGQALPGFHFIQHRLVKTKVEPGFKMVEQSEYATAFVSDLPK
GenBank: ACH67606
UniProtKB: B9UPG6
IPG: 15501371

Excerpts

No excerpts have been added for cerFP505
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change