compare

Comparison List

cEGFP

similar: EGFP

cEGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Aequorea victoria 27.3 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
489 507          

Photostability

no photostability measurements available ... add one!

cEGFP Sequence

SSLENVYIMADKQKNGIKANFKIRHNIEDGGVQLAYHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYKGGTGGSMVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLGYGVQCFSRYPDHMKQHDFFKSAMPEGYIQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYN

Structure

Deposited: ,
Chromophore (TYG):

Excerpts

No excerpts have been added for cEGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Structural Basis for Calcium Sensing by GCaMP2

Wang Q, Shui B, Kotlikoff Mi, Sondermann H

(2008). Structure, 16(12) , 1817-1827. doi: 10.1016/j.str.2008.10.008. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change