compare

Comparison List

BR1

BR1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2019, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.
+
Oligomerization Organism Molecular Weight Cofactor
? Arabidopsis thaliana 12.9 kDa Flavin

FPbase ID: WH633

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
450 495 12,500 0.45 5.62      

Photostability

No photostability measurements available ... add one!

BR1 Sequence

MIEKNYVITDPRLPDNPIIFASDGFLELTGYSREEILGRNARFLQGPETDQATVQKIRDAIRDQRETTVQLINYTKSGRKFWNLLHLQPVRDQKGELQYFIGVQLDGSDRV

Excerpts

No excerpts have been added for BR1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Engineered Arabidopsis Blue Light Receptor LOV Domain Variants with Improved Quantum Yield, Brightness, and Thermostability

Ko S, Hwang B, Na J-H, Lee J, Jung St

(2019). Journal of Agricultural and Food Chemistry, 67(43) , 12037-12043. doi: 10.1021/acs.jafc.9b05473. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change