compare

Comparison List

BDFP1.6

BDFP1.6 is a basic (constitutively fluorescent) near ir fluorescent protein published in 2018, derived from Chroococcidiopsis. It requires the cofactor biliverdin for fluorescence.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Dimer Chroococcidiopsis 16.6 kDa Biliverdin

FPbase ID: QNYK6

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
642 666 100,000 0.197 19.7      

Photostability

No photostability measurements available ... add one!

BDFP1.6 Sequence

MANREVVETLKELLADGEKRVQVAGVIGTNAAEVVKTAVSLLFQEYPELVSPGGCAYTTRRYNMCVRDMNYFLRMCSYAIVAGGASVLDGRMLAGFRDTFNSLGIPLCPAARGIQLMKKIVKEKLATAGMTNIAFVDEPFDYIARVISETEI
GenBank: MG727536

Excerpts

No excerpts have been added for BDFP1.6
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Far-red acclimating cyanobacterium as versatile source for bright fluorescent biomarkers

Ding W-L, Hou Y-N, Tan Z-Z, Jiang S-P, Miao D, Losi A, Gärtner W, Scheer H, Zhao K-H

(2018). Biochimica et Biophysica Acta (BBA) - Molecular Cell Research, 1865(11) , 1649-1656. doi: 10.1016/j.bbamcr.2018.08.015. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change