compare

Comparison List

AzamiRed1.0

AzamiRed1.0 is a basic (constitutively fluorescent) red fluorescent protein published in 2023, derived from Galaxea fascicularis.
+
AzamiRed1.0 Spectrum Fluorescent protein AzamiRed1.0 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Galaxea fascicularis 25.8 kDa -

FPbase ID: 1NUNN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
571 606 34,100 0.65 22.16      

Photostability

No photostability measurements available ... add one!

AzamiRed1.0 Sequence

MVSVIKEEMKIKLRMEGTVNGHNFVIEGEGKGNPYEGTQTMDLKVTEGGPLPFAYDILSPQFMYGSKAFIKYPADIPDYFKQSFPEGFHWERVMTYEDGGVCTATQNTSLRGDCFFYDVRFDGVNFPPNGPVMQKKTLGWEPSTEKMYVRDGVLKGDVIKALLLEGGGHYRCDFKTTYKAKKDVRLPGYHFVDHRIEILKHDKDYNKVKQYENAVARYSMLPSQAK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for AzamiRed1.0
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Red fluorescent proteins engineered from green fluorescent proteins

Imamura H, Otsubo S, Nishida M, Takekawa N, Imada K

(2023). Proceedings of the National Academy of Sciences, 120(45) , e2307687120. doi: 10.1073/pnas.2307687120. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change