compare

Comparison List

asCP562

a.k.a. asulCP562

asCP562 is a basic (constitutively fluorescent) red fluorescent protein published in 2000, derived from Anemonia sulcata.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia sulcata 26.0 kDa -

FPbase ID: 3NV4W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
562 595          

Photostability

No photostability measurements available ... add one!

asCP562 Sequence

MASFLKKTMPFKTTIEGTVNGHYFKCTGKGEGNPFEGTQEMKIEVIEGGPLPFAFHILSTSCMYGSKTFIKYVSGIPDYFKQSFPEGFTWERTTTYEDGGFLTAHQDTSLDGDCLVYKVKILGNNFPADGPVMQNKAERWEPATEILYEVDGVLRGQSLMALKCPGGRHLTCHLHSTYRSKKPASALKMPGFHFGDHRIEIMEEVEKGKCYKQYEAAVARYCDAAPSKLGHH
GenBank: AAG41206
UniProtKB: Q9GPI5
IPG: 1236053

Excerpts

No excerpts have been added for asCP562
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Cracks in the beta -can: Fluorescent proteins from Anemonia sulcata (Anthozoa, Actinaria)

Wiedenmann J, Elke C, Spindler K-D, Funke W

(2000). Proceedings of the National Academy of Sciences, 97(26) , 14091-14096. doi: 10.1073/pnas.97.26.14091. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change