compare

Comparison List

apulCP584

apulCP584 is a fluorescent protein published in 2008, derived from Acropora pulchra. It is reported to be a tetramer.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora pulchra 25.0 kDa -

FPbase ID: S7VLN

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
584            

Photostability

No photostability measurements available ... add one!

apulCP584 Sequence

MSVIAKQMTYKVYMSGTVNGHYFEVEGDGKGKPYEGEQTVRLAVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYHVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQCEISIARKPVVA
GenBank: ACH89425
UniProtKB: B5T1L1
IPG: 15616239

Excerpts

No excerpts have been added for apulCP584
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue light regulation of host pigment in reef-building corals

D’Angelo C, Denzel A, Vogt A, Matz Mv, Oswald F, Salih A, Nienhaus Gu, Wiedenmann J

(2008). Marine Ecology Progress Series, 364, 97-106. doi: 10.3354/meps07588. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change