compare

Comparison List

anobGFP

anobGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora nobilis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora nobilis 25.9 kDa -

FPbase ID: W1X8H

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
502 511 96,200 0.6 57.72      

Photostability

No photostability measurements available ... add one!

anobGFP Sequence

MSYSKQGIAQEMKTKYHMEGSVNGHEFTIEGVGTGYPYEGKQMSELVIIKPAGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWKIRLEGNCFIHNSIFNGVNFPADGPVMEKKTIGWDKSFEKMTVSKEVLRGDVTMFLMLEGGGSHRCQFHSTYKTEKPVTLPPNHVVEHQIVRTDLGQSAKGFTVKLEAHAAAHVNPLKVK
GenBank: AAU06847
UniProtKB: Q66PV7
IPG: 3620741

Excerpts

No excerpts have been added for anobGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change