compare

Comparison List

anobCFP2

anobCFP2 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora nobilis.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Acropora nobilis 25.7 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
477 495 67,200 0.49 32.93      

Photostability

no photostability measurements available ... add one!

anobCFP2 Sequence

MSYSKQGIAQVMKTKYHMEGSVNGHEFTIEGVGTGNPYEGTQMSELVITKPAGKPLPFSFDILSTVFQYGNRCFTKYPEGMTDYFKQAFPDGMSYERSFLYEDGGVATAGWNIGLERDCFIHKSIYHGVNFPADGPVMKKKTIGWDKAFEKMTVSKDVLRGDVTGFLMLEGGGYHSCQFHSTYKPEKPAALPPNHVVEHHIVRTDLGQSAKGFTVKLEEHAAAHVNPLKVQ
GenBank: AAU06850
UniProtKB: Q66PV4
IPG: 3620748

Excerpts

No excerpts have been added for anobCFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change