compare

Comparison List

anobCFP1

anobCFP1 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2008, derived from Acropora nobilis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora nobilis 25.9 kDa -

FPbase ID: NPCN7

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
462 490 27,600 0.86 23.74      

Photostability

No photostability measurements available ... add one!

anobCFP1 Sequence

MSYSKQGIAQVMKTKYHMEGSVNGHEFTIEGVGTGNPYEGTQMSELVITKPAGKPLPFSFDILSTVFQYGNRCFTKYPEGMTDYFKQAFPDGMSYERSFLYEDGGVATASWNIRLERDCFIHKSIYHGVNFPADGPVMKKKTIGWDKAFEKMTVSKDVLRGDVTEFLMLEGGGYHSCQFHSTYKPEKPAALPPNHVVEHHIVRTDLGQSAKGFTVKLEEHAAAHVNPLKVQ
GenBank: AAU06851
UniProtKB: Q66PV3
IPG: 3620753

Excerpts

No excerpts have been added for anobCFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change