compare

Comparison List

anm2CP

anm2CP is a basic (constitutively fluorescent) red fluorescent protein published in 2004, derived from Anthoathecata.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Anthoathecata 25.9 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
572 597 120,000 0.001 0.12      

Photostability

no photostability measurements available ... add one!

anm2CP Sequence

MEGGPALFQSDMTFKIFIDGVVNDQKFTIIADGSSKFPHGDFNVHAVCETGKLPMSWKPICHLIQYGEPFFAKYPNGISHFAQECFPEGLTIDRTVRFENDGTMTSHHTYELDGTCVISRITVNCDGFQPDGPIMKDQLVDILPTETHMFPHGSNAVRQLCYIGFTTADGGLMMSHFDSKLTFNGSRAIKIPGPHFVTVIIKQMKDTSDKRDHVCQREVTYAHSVPRITSAI
GenBank: AAR85352
UniProtKB: Q6RYS4
IPG: 1978504

Excerpts

No excerpts have been added for anm2CP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change