compare

Comparison List

amilFP597

amilFP597 is a basic (constitutively fluorescent) red fluorescent protein published in 2008, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora millepora 26.1 kDa -

FPbase ID: 2YKB1

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
558 597          
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

amilFP597 Sequence

BLAST
MALSKHGLTKDMTMKYHMEGSVDGHKFVITGHGNGNPFEGKQTVNLCVAEGGPLPFSEDILSAAFDYGNRVFTEYPQGMVDFFKNSCPAGYTWHRSLLFEDGAVCTTSADITVSVEENCFYHNSKFHGVNFPADGPVMKKMTTNWEPSCEKIIPVPRQGILKGDIAMYLLLKDGGRYRCQFDTIYKAKSDPKEMPEWHFIQHKLTREDRSDAKNQKWQLVEHAVASRSALPG
GenBank: ACH89429
UniProtKB: B5T1L5
IPG: 15616243

Excerpts

No excerpts have been added for amilFP597
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue light regulation of host pigment in reef-building corals

D’Angelo C, Denzel A, Vogt A, Matz Mv, Oswald F, Salih A, Nienhaus Gu, Wiedenmann J

(2008). Marine Ecology Progress Series, 364, 97-106. doi: 10.3354/meps07588. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change