compare

Comparison List

amilFP593

a.k.a. amilRFP

amilFP593 is a basic (constitutively fluorescent) red fluorescent protein published in 2007, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Acropora millepora 26.1 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
562 593 90,900 0.49 44.54      

Photostability

no photostability measurements available ... add one!

amilFP593 Sequence

MALSKHGLTKDMTMKYHMEGSVDGHKFVITGHGNGNPFEGKQTMNLCVVEGGPLPFSEDILSAAFDYGNRVFTEYPQGMVDFFKNSCPAGYTWHRSLLFEDGAVCTTSADITVSVEENCFYHNSKFHGVNFPADGPVMKKMTTNWEPSCEKIIPVPRQGILKGDIAMYLLLKDGGRYRCQFDTIYKAKSDPKEMPEWHFIQHKLTREDRSDAKNQKWQLVEHAVASRSALPG
GenBank: AAU06852
UniProtKB: Q66PV2
IPG: 3620742

Excerpts

No excerpts have been added for amilFP593
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence lifetime imaging of coral fluorescent proteins

Cox G, Matz M, Salih A

(2007). Microscopy Research and Technique, 70(3) , 243-251. doi: 10.1002/jemt.20410. Article   Pubmed

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change