compare

Comparison List

amilFP513

a.k.a. amilGFP

amilFP513 is a basic (constitutively fluorescent) green fluorescent protein published in 2007, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora millepora 26.0 kDa -

FPbase ID: LO7EL

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 513 75,200 0.67 50.38      

Photostability

No photostability measurements available ... add one!

amilFP513 Sequence

MSYSKQGIVQEMKTKYHMEGSVNGHEFTIEGVGTGYPYEGKQMSELVIIKPAGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHKSIFHGVNFPADGPVMKKKTIDWDKSFEKMTVSKEVLRGDVTMFLMLEGGGSHRCQFHSTYKTEKPVTLPPNHVVEHQIVRTDLGQSAKGFTVKLEAHAAAHVNPLKVK
GenBank: AAU06846
UniProtKB: Q66PV8
IPG: 3620747

Excerpts

No excerpts have been added for amilFP513
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence lifetime imaging of coral fluorescent proteins

Cox G, Matz M, Salih A

(2007). Microscopy Research and Technique, 70(3) , 243-251. doi: 10.1002/jemt.20410. Article   Pubmed

Additional References

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change