compare

Comparison List

amilFP504

amilFP504 is a basic (constitutively fluorescent) green fluorescent protein published in 2007, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Acropora millepora 25.6 kDa -

FPbase ID: WQ5JF

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
488 504          

Photostability

No photostability measurements available ... add one!

amilFP504 Sequence

MSYSKQGIVQEMKTKYHMEGSVNGHEFTIEGVGTGYPYEGKQISELVIIKPAGKPLPFSFDILSSVFQYGNRCFTKYPADMPDYFKQAFPDGMSYERSFLFEDGAVATASWNIRLEGNCFIHKSIFHGVNFPADGPVMKKKTIDWDKSFEKMTVSKEVLRGDVTMFLMLEGGGSHRCQFHSTYKTEKPVTLPPNHVVEHQIVRTDLGQTAKGFTVKLEEHAAAHVSL
GenBank: ABB17973
UniProtKB: A8CLY3
IPG: 4901501

Excerpts

No excerpts have been added for amilFP504
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence lifetime imaging of coral fluorescent proteins

Cox G, Matz M, Salih A

(2007). Microscopy Research and Technique, 70(3) , 243-251. doi: 10.1002/jemt.20410. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change