compare

Comparison List

amilFP497

amilFP497 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora millepora 25.9 kDa -

FPbase ID: VGW8W

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
477 497          

Photostability

No photostability measurements available ... add one!

amilFP497 Sequence

MSYSKQGIVQAMKTKYHMEGSVNGHEFTIEGVGTGNPYEGTQMSELVITKPAGKPLPFSFDILSTVFQYGNRCFTKYPEGMTDYFKQAFPDGMSYERSFLFEDGGVATASWNIRLEGDCFIHKSIYHGVNFPADGPVMKKKTIGWEKSFEKMTVSKDVLRGDVTMFLMLEGGGYHRCQFHSTYKPEKPGTLPPNHVVEHHIVRTDLGQSAKGFTVKLEEHAAAHVNPLKVK
GenBank: ACH89427
UniProtKB: B5T1L3
IPG: 15616241

Excerpts

No excerpts have been added for amilFP497
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue light regulation of host pigment in reef-building corals

D’Angelo C, Denzel A, Vogt A, Matz Mv, Oswald F, Salih A, Nienhaus Gu, Wiedenmann J

(2008). Marine Ecology Progress Series, 364, 97-106. doi: 10.3354/meps07588. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change