compare

Comparison List

amilFP490

a.k.a. amilCFP

amilFP490 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2007, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Acropora millepora 26.0 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
424 490 29,500 0.9 26.55      

Photostability

no photostability measurements available ... add one!

amilFP490 Sequence

MSYSKQGIAQVMKTKYHMEGSVNGHEFTIEGVGTGNPYEGTQMSELVITKPAGKPLPFSFDILSTVFQYGNRCFTKYPEGMTDYFKQAFPDGMSFERSFLYEDGGVATASWNIRLERDCFIHKSIYHGVNFPADGPVMKKKTIGWDKAFEKMTVSKDVLRGDVTEFLMLEGGGYHSCQFHSTYKPEKPVTLPPNHVVEHHIVRTDLGQTAKGFTVKLEEHAAAHVNPLKVQ
GenBank: AAU06849
UniProtKB: Q66PV5
IPG: 3620749

Excerpts

No excerpts have been added for amilFP490
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Fluorescence lifetime imaging of coral fluorescent proteins

Cox G, Matz M, Salih A

(2007). Microscopy Research and Technique, 70(3) , 243-251. doi: 10.1002/jemt.20410. Article   Pubmed

Additional References

External Resources

Something missing or incorrect? Submit a change Submit a change