compare

Comparison List

amilFP484

amilFP484 is a basic (constitutively fluorescent) blue fluorescent protein published in 2008, derived from Acropora millepora.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora millepora 26.1 kDa -

FPbase ID: 9MM4N

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
420 484          

Photostability

No photostability measurements available ... add one!

amilFP484 Sequence

MSYSKQGIVQEMKTKYHMEGSVNGHEFTIEGVGTGNPYEGTQMSELVITKPAGKPLPFSFDILSTVFQYGNRCFTKYPEGMTDYFKQAFPDGMSYERSFLYEDGGVATASWNIRLERDCFIHKSIYHGVNFPADGPVMKKKTIGWDKAFEKMTVSKDVLRGDVTEFLMLEGGGYHSCQFHSTYKPEKPVTLPPNHVVEHHIVRTDLGQRAKGFTVKLEEHAAAHVNPLKVK
GenBank: ACH89426
UniProtKB: B5T1L2
IPG: 15616240

Excerpts

No excerpts have been added for amilFP484
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Blue light regulation of host pigment in reef-building corals

D’Angelo C, Denzel A, Vogt A, Matz Mv, Oswald F, Salih A, Nienhaus Gu, Wiedenmann J

(2008). Marine Ecology Progress Series, 364, 97-106. doi: 10.3354/meps07588. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change