compare

Comparison List

amilCP586

amilCP586 is a fluorescent protein published in 2013, derived from Acropora millepora.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Acropora millepora 25.0 kDa -

FPbase ID: VAFG4

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

amilCP586 Sequence

MSVIAKQMTYKVYVSGTVNGHYFEVEGDGKGKPYEGEQTVRLAVTKGGPLPFAWDILSPQCQYGSIPFTKYPEDIPDYVKQSFPEGYTWERIMNFEDGAVCTVSNDSSIQGNCFIYHVKFSGLNFPPNGPVMQKKTQGWEPNTERLFARDGMLIGNNFMALKLEGGGHYLCEFKSTYKAKKPVKMPGYHYVDRKLDVTNHNKDYTSVEQREISIARKPVVA
GenBank: AGH32878
UniProtKB: M4QUP7
IPG: 34398773

Excerpts

No excerpts have been added for amilCP586
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change