compare

Comparison List

alajGFP3

alajGFP3 is a basic (constitutively fluorescent) green fluorescent protein published in 2004, derived from Astrangia lajollaensis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Astrangia lajollaensis 25.2 kDa -

FPbase ID: V25UH

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
494 504          

Photostability

No photostability measurements available ... add one!

alajGFP3 Sequence

MALSKQEIKKEMTMDYVMDGCVNGHSFTVKGDGAGKPYEGHQRLSLHVTGGQPLPFAFDILSAAFAYGNRCFTKYPKEIPDMFKQAFPGGMSWERTMTFEDGGVASVSADISIEKDGCFKHRSKFVGVNFPVNGPVMQNKTRGWEPSIEKMTVRDGTLKGHVTMFLKLEGGGNYRCDFETTYKAKKAVKMLDSHFIEHRLVTTIRGNNVELQEDAEARNSGLGECK
GenBank: AAS18272
UniProtKB: Q6R8F3
IPG: 2033751

Excerpts

No excerpts have been added for alajGFP3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Flow Cytometric Screening of cDNA Expression Libraries for Fluorescent Proteins

Bessette Ph, Daugherty Ps

(2004). Biotechnology Progress, 20(3) , 963-967. doi: 10.1021/bp034308g. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change