compare

Comparison List

alajGFP2

alajGFP2 is a basic (constitutively fluorescent) green/yellow fluorescent protein published in 2004, derived from Astrangia lajollaensis.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Astrangia lajollaensis 24.7 kDa -

FPbase ID: RFJ23

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
509 517          

Photostability

No photostability measurements available ... add one!

alajGFP2 Sequence

MVLSKQMNMTYLMDGSVNGHNFTVEGEGDGKPYEGHQCLKLRITKGEPLPFAFDILTAAFCYGNRCFVNYPAEIADYFKQAFPEGLTWERSMTFEDGGFAAVSADLSLKNGNWFVHQSKFVGVNFPADGPVMQKKTVGWEPSTEKMIVRDGTLEGDVTMYLKLEGGGNYRCDYRTIYKAKKDVKMPKSHFVEHTLVRNNIKKDAKGNTIELIEDASARY
GenBank: AAS18271
UniProtKB: Q6R8F4
IPG: 2033714

Excerpts

No excerpts have been added for alajGFP2
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Flow Cytometric Screening of cDNA Expression Libraries for Fluorescent Proteins

Bessette Ph, Daugherty Ps

(2004). Biotechnology Progress, 20(3) , 963-967. doi: 10.1021/bp034308g. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change