compare

Comparison List

AdRed

AdRed is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Acropora digitifera.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Tetramer Acropora digitifera 26.1 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
562 612          

Photostability

no photostability measurements available ... add one!

AdRed Sequence

MALSKHGLTKDMTMKYRMEGCVDGHKFVITGHGNGSPFEGKQTINLCVVEGGPLPFSEDILSAVFDYGNRVFTDYPQGMVDFFKNSCPAGYTWQRSLLFEDGAVCTASADITVSVEENCFYHESKFHGVNFPADGPVMKKMTINWEPCCEKIIPVPRQGILKGDVAMYLLLKDGGRYRCQFDTVYKAKTDSKKMPEWHFIQHKLTREDRSDAKNQKWQLAEHSVASRSALP

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for AdRed
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change