compare

Comparison List

AdRed

AdRed is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Acropora digitifera. It has low acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora digitifera 26.1 kDa -

FPbase ID: DAH3B

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
567 612     4.0    

Photostability

No photostability measurements available ... add one!

AdRed Sequence

MALSKHGLTKDMTMKYRMEGCVDGHKFVITGHGNGSPFEGKQTINLCVVEGGPLPFSEDILSAVFDYGNRVFTDYPQGMVDFFKNSCPAGYTWQRSLLFEDGAVCTASADITVSVEENCFYHESKFHGVNFPADGPVMKKMTINWEPCCEKIIPVPRQGILKGDVAMYLLLKDGGRYRCQFDTVYKAKTDSKKMPEWHFIQHKLTREDRSDAKNQKWQLAEHSVASRSALP
UniProtKB: A0A1S7IWI8

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for AdRed
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change