compare

Comparison List

AdRed-C148S

AdRed-C148S is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Acropora digitifera.
+
Oligomerization Organism Molecular Weight Cofactor
? Acropora digitifera 26.0 kDa -

FPbase ID: THMOX

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
560 599          

Photostability

No photostability measurements available ... add one!

AdRed-C148S Sequence

MALSKHGLTKDMTMKYRMEGCVDGHKFVITGHGNGSPFEGKQTINLCVVEGGPLPFSEDILSAVFDYGNRVFTDYPQGMVDFFKNSCPAGYTWQRSLLFEDGAVCTASADITVSVEENCFYHESKFHGVNFPADGPVMKKMTINWEPSCEKIIPVPRQGILKGDVAMYLLLKDGGRYRCQFDTVYKAKTDSKKMPEWHFIQHKLTREDRSDAKNQKWQLAEHSVASRSALP

Excerpts

No excerpts have been added for AdRed-C148S
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Something missing or incorrect? Submit a change Submit a change