compare

Comparison List

acanFP

acanFP is a fluorescent protein published in 2009, derived from Anthoathecata.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Anthoathecata kDa -

FPbase ID: 24DHR

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

acanFP Sequence

AIKPDMKIKLCMEGAVNGHPFMIEGEGKGKPFDGKQNMELKVKEGGPLPFAYDILTTVFNYGNRVFAKYPRDIADYFKQSFPEGFSWERSMAYEDGGICIATNNITLMKGDCFXYXIRFDGVNFPANXPVMQKKXVKWEPSTEKLYVRDGVLKGDINMALLLEGGGHYRCDFKTT
GenBank: ACV52387
UniProtKB: D1KWU4
IPG: 18466459

Excerpts

No excerpts have been added for acanFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Novel Internal Regions of Fluorescent Proteins Undergo Divergent Evolutionary Patterns

Gruber Df, Desalle R, Lienau Ek, Tchernov D, Pieribone Va, Kao H-T

(2009). Molecular Biology and Evolution, 26(12) , 2841-2848. doi: 10.1093/molbev/msp194. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change