compare

Comparison List

aacuGFP1

aacuGFP1 is a basic (constitutively fluorescent) green fluorescent protein published in 2008, derived from Acropora aculeus.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Tetramer Acropora aculeus 25.7 kDa -

FPbase ID: 498LC

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
478 502 36,900 0.61 22.51      

Photostability

No photostability measurements available ... add one!

aacuGFP1 Sequence

MSLSKHGITQEMPTKYHMKGSVNGHEFEIEGVGTGHPYEGTHMAELVIIKPAGKPLPFSFDILSTVIQYGNRCFTKYPADLPDYFKQAYPGGMSYERSFVYQDGGIATASWNVGLEGNCFIHKSTYLGVNFPADGPVMTKKTIGWDKAFEKMTGFNEVLRGDVTEFLMLEGGGYHSCQFHSTYKPEKPVELPPNHVIEHHIVRTDLGKTAKGFMVKLVQHAAAHVNPLKVQ
GenBank: AAU06848
UniProtKB: Q66PV6
IPG: 3620743

Excerpts

No excerpts have been added for aacuGFP1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change