compare

Comparison List

A1a

A1a is a fluorescent protein published in 2007, derived from Acropora millepora.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Acropora millepora 26.1 kDa -

FPbase ID: 7XNWJ

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

A1a Sequence

MALSKHGLTKDMTMKYHMEGSVDGHKFVITGHGDGNPFEGKQTINLCVAEGGPLPFSEDILSAAFDYGNRVFTEYPQGMVDFFKNSCPAGYTWHRSLLFEDGAVCTTSADITVSVEENCFYHNSKFHGVNFPADGPVMKKMTTNWEPSCEKIIPVPRQGILKGDIAMYLLLKDGGRYRCQFDTIYKAKSDPKEMPEWHFIQHKLTREDRSDAKNQKWQLVEHAVASRSALPG
GenBank: AAT77753
UniProtKB: Q692V6
IPG: 3563998

Excerpts

No excerpts have been added for A1a
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change