compare

Comparison List

SOPP

a.k.a. singlet oxygen photosensitizing protein, Q103L miniSOG

SOPP is a basic (constitutively fluorescent) cyan fluorescent protein published in 2015, derived from Arabidopsis thaliana. It requires the cofactor flavin for fluorescence.
+
SOPP Spectrum Fluorescent protein SOPP excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Arabidopsis thaliana 12.3 kDa Flavin

FPbase ID: VVQ8D

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
440 487 14,500 0.39 5.66      

Photostability

No photostability measurements available ... add one!

SOPP Sequence

MEKSFVITDPRLPDNPIIFASDGFLELTEYSREEILGRNGRFLQGPETDQATVQKIRDAIRDQREITVQLINYTKSGKKFWNLLHLQPMRDQKGELQYFIGVLLDG

Excerpts

No excerpts have been added for SOPP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Rational Design of an Efficient, Genetically Encodable, Protein-Encased Singlet Oxygen Photosensitizer

Westberg M, Holmegaard L, Pimenta Fm, Etzerodt M, Ogilby Pr

(2015). Journal of the American Chemical Society, 137(4) , 1632-1642. doi: 10.1021/ja511940j. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change