compare

Comparison List

Superfolder mTurquoise2 ox

a.k.a. sfTq2ox

Superfolder mTurquoise2 ox is a basic (constitutively fluorescent) cyan fluorescent protein published in 2019, derived from Aequorea victoria.
+
Superfolder mTurquoise2 ox Spectrum Fluorescent protein Superfolder mTurquoise2 ox excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Aequorea victoria 26.8 kDa -

FPbase ID: QEXW4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
434 474          

Superfolder mTurquoise2 ox OSER Measurements

% Normal Cells OSER/NE ratio Cell Type Reference
88.0 - - Meiresonne et al. (2019)

Photostability

No photostability measurements available ... add one!

Superfolder mTurquoise2 ox Sequence

Superfolder mTurquoise2 ox was derived from Superfolder mTurquoise2 with the following mutations: C70V
amino acid numbers relative to avGFP. show relative to Superfolder mTurquoise2

MVSKGEELFTGVVPILVELDGDVNGHKFSVRGEGEGDATNGKLTLKFICTTGKLPVPWPTLVTTLSWGVQVFARYPDHMKQHDFFKSAMPEGYVQERTISFKDDGTYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYFSDNVYITADKQKNGIKANFKIRHNVEDGGVQLADHYQQNTPIGDGPVLLPDNHYLSTQSKLSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Superfolder mTurquoise2 ox
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change