compare

Comparison List

phiLOV3

phiLOV3 is a basic (constitutively fluorescent) cyan fluorescent protein published in 2021, derived from Arabidopsis thaliana. It has very low acid sensitivity. It requires the cofactor flavin for fluorescence.
+
phiLOV3 Spectrum Fluorescent protein phiLOV3 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Arabidopsis thaliana 12.7 kDa Flavin

FPbase ID: PG1ZQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
452 502 15,800 0.22 3.48 3.3    

Photostability

No photostability measurements available ... add one!

phiLOV3 Sequence

MEKSFVITDPRLPDYPIIFASDGFLELTEYSREEIMGRNARFLQGPETDQATVQKIRDAIRDRRETTVQLINYTKSGKKFWNLLHLQPVRDGKGGLQYFIGVQLVGSDHV
GenBank: MZ682637

Excerpts

No excerpts have been added for phiLOV3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change