compare

Comparison List

eUnaG

eUnaG is a basic (constitutively fluorescent) fluorescent protein published in 2017, derived from Anguilla japonica. It requires the cofactor bilirubin for fluorescence.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization Organism Molecular Weight Cofactor
? Anguilla japonica 15.6 kDa Bilirubin

FPbase ID: PARJ2

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

eUnaG Sequence

BLAST
MLEKFVGTWKIADSHNFGEYLKAIGAPKELSDGGDATTPTLYISQKDGDKMTVKIENGPPTFLDTQVKFKLGEEFDEFPSDRRKGVKSVVNLVGEKLVYVQKWDGKETTYVREIKDGKLVVTLTMGDVVAVRSYRRATE

Excerpts

No excerpts have been added for eUnaG
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

eUnaG: a new ligand-inducible fluorescent reporter to detect drug transporter activity in live cells

Yeh Jt-H, Nam K, Yeh Jt-H, Perrimon N

(2017). Scientific Reports, 7(1) , 41619. doi: 10.1038/srep41619. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change