compare

Comparison List

amCyan1

a.k.a. amCyan

amCyan1 is a basic (constitutively fluorescent) cyan fluorescent protein, derived from Anemonia majano.
+
amCyan1 Spectrum Fluorescent protein amCyan1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Tetramer Anemonia majano 25.3 kDa -

FPbase ID: L5QET

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
453 486          

Photostability

No photostability measurements available ... add one!

amCyan1 Sequence

MALSNKFIGDDMKMTYHMDGCVNGHYFTVKGEGSGKPYEGTQTSTFKVTMANGGPLAFSFDILSTVFMYGNRCFTAYPTSMPDYFKQAFPDGMSYERTFTYEDGGVATASWEISLKGNCFEHKSTFHGVNFPADGPVMAKMTTGWDPSFEKMTVCDGILKGDVTAFLMLQGGGNYRCQFHTSYKTKKPVTMPPNHAVEHRIARTDLDKGGNSVQLTEHAVAHITSVVPF

Excerpts

No excerpts have been added for amCyan1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change