compare

Comparison List

mGinger1

mGinger1 is a basic (constitutively fluorescent) red fluorescent protein published in 2018, derived from Heteractis crispa. It has high acid sensitivity.
+
mGinger1 Spectrum Fluorescent protein mGinger1 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Heteractis crispa 24.8 kDa -

FPbase ID: AQ2DU

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
587 637 58,000 0.02 1.16 7.9 106.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

mGinger1 Sequence

BLAST

mGinger1 was derived from HcRed7 with the following mutations: A2_G3del/S8N/R10H/E27K/I43V/H71R/H72Y/T73P/E75D/N135K/K136E/S137T/G138C/V146S/C155R/V159H/R167S/I170H/Y174S/S176T/V183E/T187I/G190P/F191R/F193S/R197C/M200I/L201T/R202S/K203H/K205D/A214T/L222_N227del

MLLKENMHIKMYMEGTVNGHYFKCKGEGDGNPFAGTQSMRVHVTEGAPLPFAFDILAPCCEYGSKTFVRYPADIPDFFKQSFPEGFTWERTTTYEDGGILTAHQDTSLEGNCLIYKVKVHGTNFPADGPVMKKETCGWEPSTESVYPENGVLRGRNHMALKVGDSHLHCHHSTTYRSKKAERALIMPPRHSTDYCLQITSHKDDEYFELYETSVARYSD
GenBank: MK040729

Excerpts

No excerpts have been added for mGinger1
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Monomerization of far-red fluorescent proteins

Wannier Tm, Gillespie Sk, Hutchins N, Mcisaac Rs, Wu S-Y, Shen Y, Campbell Re, Brown Ks, Mayo Sl

(2018). Proceedings of the National Academy of Sciences, 115(48) , E11294-E11301. doi: 10.1073/pnas.1807449115. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change