compare

Comparison List

LSSmScarlet3

LSSmScarlet3 is a basic (constitutively fluorescent) long stokes shift fluorescent protein published in 2022, derived from synthetic construct. It is reported to be a rapidly-maturing monomer with very low acid sensitivity.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
Monomer synthetic construct 26.3 kDa -

FPbase ID: 86FNG

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
466 598 27,300 0.36 9.83 2.18 34.0  
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

LSSmScarlet3 Sequence

BLAST

LSSmScarlet3 was derived from LSSmScarlet2 with the following mutations: G170D

MVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFSWDILSPQFMYGSRAFTKHPADIPDYHKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGTLIYEVKLRGTNFPPDGPVMQKKTMGLEADTERLYPEDGVLKGDIKMALRLKDGGRYLAHVRTTYKAKKPVLMPGAYNVDRKLDITSHNEDYTVVEQFERSEGRHSTGDMDELYK

Excerpts

No excerpts have been added for LSSmScarlet3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

LSSmScarlet2 and LSSmScarlet3, Chemically Stable Genetically Encoded Red Fluorescent Proteins with a Large Stokes’ Shift

Subach Om, Vlaskina Av, Agapova Yk, Piatkevich Kd, Patrushev Mv, Samygina Vr, Subach Fv

(2022). International Journal of Molecular Sciences, 23(19) , 11051. doi: 10.3390/ijms231911051. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change