compare

Comparison List

Lumazine binding protein

a.k.a. LUMP

Lumazine binding protein is a basic (constitutively fluorescent) blue fluorescent protein published in 2015, derived from Photobacterium leiognathi. It requires the cofactor ribityl-lumazine for fluorescence.
+
Lumazine binding protein Spectrum Fluorescent protein Lumazine binding protein excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
? Photobacterium leiognathi 20.0 kDa ribityl-lumazine

FPbase ID: 6TP83

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
420 470 0.55       13.6

Photostability

No photostability measurements available ... add one!

Lumazine binding protein Sequence

MFRGIVQGRGVIRSISKSEDSQRHGIAFPEGMFQLVDVDTVMLVNGCSLTVVRILGDMVYFDIDQALGTTTFDGLKEGDQVNLEIHPKFGEVVGRGGLTGNIKGTALVAAIEENDAGFSVLIDIPKGLAENLTVKDDIGIDGISLPITDMSDSIITLNYSRDLLASTNIASLAKDVKVNVEILNEW

Excerpts

No excerpts have been added for Lumazine binding protein
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Genetically encoded sensors of protein hydrodynamics and molecular proximity

Hoepker Ac, Wang A, Le Marois A, Suhling K, Yan Y, Marriott G

(2015). Proceedings of the National Academy of Sciences, 112(20) , E2569-E2574. doi: 10.1073/pnas.1424021112. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change