compare

Comparison List

mTFP0.7

mTFP0.7 is a multistate cyan fluorescent protein published in 2006, derived from Clavularia sp..
+
mTFP0.7 Spectrum Fluorescent protein mTFP0.7 excitation and emission spectra
Oligomerization Organism Molecular Weight Cofactor
Monomer Clavularia sp. 27.0 kDa -

FPbase ID: 2HEJS

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Off              
On 453 488 60,000 0.5 30.0      
Edit state transitions

Photostability

No photostability measurements available ... add one!

mTFP0.7 Sequence

mTFP0.7 was derived from mTFP0.6 with the following mutations: N25S/V82I/R161H/Y211H/V224A
amino acid numbers relative to cFP484. show relative to mTFP0.6

MVSKGEETTMGVIKPDMKIKLKMEGNVNGHAFVIEGEGEGKPYDGTNTINLEVKEGAPLPFSYDILTNAFAYGNRAFTKYPDDIPNYFKQSFPEGYSWERTMTFEDKGIVKVKSDISMEEDSFIYEIHLKGENFPPNGPVMQKKTLKWEPSTEILYVRDGVLVGDIKHKLLLEGGGHHRVDFKTIYRAKKAVKLPDYHFVDHRIEILNHDKDYNKVTVYESAVARYSTGGMDELYK

Structure

Deposited: ,
Chromophore:

Excerpts

No excerpts have been added for mTFP0.7
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

  1. Two-photon absorption properties of fluorescent proteins

    Drobizhev M, Makarov Ns, Tillo Se, Hughes Te, Rebane A

    (2011). Nature Methods, 8(5) , 393-399. doi: 10.1038/nmeth.1596. Article   Pubmed

  2. Structural basis for reversible photobleaching of a green fluorescent protein homologue

    Henderson Jn, Ai H-, Campbell Re, Remington Sj

    (2007). Proceedings of the National Academy of Sciences, 104(16) , 6672-6677. doi: 10.1073/pnas.0700059104. Article   Pubmed

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change