compare

Comparison List

mEos

a.k.a. mEosFP

mEos is a photoconvertible red fluorescent protein published in 2004, derived from Lobophyllia hemprichii.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer Lobophyllia hemprichii 25.8 kDa -

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
Red 569 581 37,000 0.62 22.94      
Green 505 516 67,200 0.64 43.01      

Transitions

From To Switch λ
Green Red 400

Photostability

no photostability measurements available ... add one!

mEos Sequence

mEos was derived from EosFP with the following mutations: V123T/T158H

MSAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFHYGNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLLEGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPDNARR

Excerpts

No excerpts have been added for mEos
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

EosFP, a fluorescent marker protein with UV-inducible green-to-red fluorescence conversion

Wiedenmann J, Ivanchenko S, Oswald F, Schmitt F, Rocker C, Salih A, Spindler K-D, Nienhaus Gu

(2004). Proceedings of the National Academy of Sciences, 101(45) , 15905-15910. doi: 10.1073/pnas.0403668101. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change