compare

Comparison List

mCrimson3

mCrimson3 is a basic (constitutively fluorescent) red fluorescent protein.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
Monomer <add one> 27.4 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
588 615          

Photostability

no photostability measurements available ... add one!

mCrimson3 Sequence

MVSKGEELIKENMHSKLYLTGSVNGHQFKCTHEGEGKPYEGTQTNRIKVVEGGPLPFAFDILATMFMYGSKAFIKYPKGLPDYFKQSFPEGFTWERTMVFEDGGTLTATQDTSLQDGCLIYNVKLRGENFPANGPVMKQTTLGWEPSTETLYPADGALEGRCDMALKLVGGGHLHCNFKTTYKSKKPATNLKMPGVHYVDRRLERIKEADNETYVEQHEVAVARYCDLPSKLGHKLNGMDELYK

Excerpts

No excerpts have been added for mCrimson3
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change