compare

Comparison List

GFP Dronpa

GFP Dronpa is a fluorescent protein published in 2007.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? <add one> 27.6 kDa -

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

no photostability measurements available ... add one!

GFP Dronpa Sequence

MRGSHHHHHHGSLVPRGSMVSVIKPDMKIKLRMEGAVNGHPFAIEGVGLGKPFEGKQSMDLKVKEGGPLPFAYDILTTVFCYGNRVFAKYPENIVDYFKQSFPEGYSWERSMNYEDGGICNATNDITLDGDCYIYEIRFDGVNFPANGPVMQKRTVKWEPSTEKLYVRDGVLKGDVNMALSLEGGGHYRCDFKTTYKAKKVVQLPDYHFVDHHIEIKSHDKDYSNVNLHEHAEAHSELPRQAK

Structure

Deposited: ,
Chromophore (CYG):

Excerpts

No excerpts have been added for GFP Dronpa
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Structural characterization of the photoswitchable fluorescent protein Dronpa-C62S

Nam K-H, Kwon Oy, Sugiyama K, Lee W-H, Kim Yk, Song Hk, Kim Ee, Park S-Y, Jeon H, Hwang Ky

(2007). Biochemical and Biophysical Research Communications, 354(4) , 962-967. doi: 10.1016/j.bbrc.2007.01.086. Article   Pubmed

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change