compare

Comparison List

Javascript is disabled! Many pages and features of FPbase will not work properly

Emerald

You are viewing an older revision of this protein, from Dec 5, 2018 01:53:03. Click here to view the current version.

Emerald is a fluorescent protein published in 1998, derived from Aequorea victoria.

No spectrum has been submitted ... but a protein must have at least one state first. Add a state.

Oligomerization	Organism	Molecular Weight	Cofactor
?	Aequorea victoria	26.9 kDa	-

FPbase ID: GLAD6

Attributes

This protein does not yet have any fluorescent states assigned. Submit a change.

Photostability

No photostability measurements available ... add one!

Emerald Sequence

BLAST

MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFARYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHKVYITADKQKNGIKVNFKTRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK

Excerpts

No excerpts have been added for Emerald
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Chapter 2: Understanding Structure—Function Relationships in the Aequorea victoria Green Fluorescent Protein

Cubitt Ab, Woollenweber La, Heim R

(1998). Methods in Cell Biology, , 19-30. doi: 10.1016/s0091-679x(08)61946-9. Article

Additional References

No additional references have been added.

External Resources

Search Addgene for Emerald
Search RIKEN BRC for Emerald

Change history

Something missing or incorrect? Submit a change Submit a change