compare

Comparison List

cmemFP507

cmemFP507 is a basic (constitutively fluorescent) green fluorescent protein published in 2009, derived from Cerianthus membranaceus.

No spectrum has been submitted ... add a spectrum!

Aggregation Organism Molecular Weight Cofactor
? Cerianthus membranaceus 25.3 kDa -

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
486 507          

Photostability

no photostability measurements available ... add one!

cmemFP507 Sequence

MSQLDNNLSVSVYMKGNVNNHEFEYDGIGGGDPNSGQFSLKTKLRGGKPLPFSYDIITMGFQYGFRAFTKYPEGIADYFKGSFPEAFQWNRRIEFEDGGVINMSSDITYKDKVLHGDVWALGVNFPPNGPVMKNEIVMEEPSEETLTAKNGVLVGFCPKAYLLKDGSYYYGHMTTFYRSKKSGQPLPGFHFIKHRLVKTKVEPGFKMVEQAEYATAHVCDLPKPN

Excerpts

No excerpts have been added for cmemFP507
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Additional References

    No additional references yet...

External Resources

Something missing or incorrect? Submit a change Submit a change