compare

Comparison List

AausFP1

AausFP1 is a basic (constitutively fluorescent) green fluorescent protein, derived from Aequorea australis. It has moderate acid sensitivity.
+
Oligomerization Organism Molecular Weight Cofactor
Dimer Aequorea australis 25.7 kDa -

FPbase ID: C2FJQ

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
504 510 170,000 0.97 164.9 6.0    

Photostability

No photostability measurements available ... add one!

AausFP1 Sequence

MSYGALLFREKIPYVVEMEGDVEGMKFSVRGKGHGDANTGKIEASFICTTGELPVPWSSILTTVTYGAQCFAKYPNDIKDYPKSAMPEGYVQERTITFENDGVYKTRAEVTYEKGSVYNRVTLNGSGFKKGGNILGKKLEFNYNPHCIYVLPDVQNNGIKCYINIVHDVIGGGQIIAAHQQLNTPLGGGPVDIPHYHHIQAHTILSKDPKETRDHMNVVEVFRAIDCKTAYA

Excerpts

We were surprised to discover a second green-emitting FP in A. cf. australis, AausFP1, that shares only 53% amino acid identity with avGFP (see Fig. 4). AausFP1 is the brightest FP discovered to date, with a nearly perfect quantum yield (0.97) and a peak extinction coefficient of 170,000 M−1cm−1, making it nearly fivefold brighter than EGFP on a per-molecule basis. These already extraordinary properties are further bolstered by a low fluorescence pKa (4.4) and unusually narrow excitation and emission peaks (see Fig. 3; the emission peak of AausFP1 has a full width at half maximum (FWHM) of 19nm, compared to 32nm for EGFP).

Lambert et al. (2019)

Primary Reference

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change