compare

Comparison List

pHluorin, ratiometric

a.k.a. ratiometric pHluorin; pHluorin

pHluorin, ratiometric is a multistate long stokes shift fluorescent protein published in 1998, derived from Aequorea victoria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Aequorea victoria 26.9 kDa -

FPbase ID: XKELZ

Attributes

State Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
acidic 475 509          
alkaline 395 509          
Edit States/Attributes
Edit state transitions

Photostability

No photostability measurements available ... add one!

pHluorin, ratiometric Sequence

BLAST

pHluorin, ratiometric was derived from avGFP with the following mutations: Q80R/E132D/S147E/N149L/I161T/V163A/N164I/K166Q/I167V/R168H/S175G/S202H

MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTFSYGVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKDDGNILGHKLEYNYNEHLVYIMADKQKNGTKAIFQVHHNIEDGGVQLADHYQQNTPIGDGPVLLPDNHYLHTQSALSKDPNEKRDHMVLLEFVTAAGITHGMDELYK
GenBank: AAC40225

Excerpts

No excerpts have been added for pHluorin, ratiometric
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Visualizing secretion and synaptic transmission with pH-sensitive green fluorescent proteins

Miesenböck G, De Angelis Da, Rothman Je

(1998). Nature, 394(6689) , 192-195. doi: 10.1038/28190. Article   Pubmed

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change