compare

Comparison List

cgreGFP

cgreGFP is a basic (constitutively fluorescent) green fluorescent protein published in 2010, derived from Clytia gregaria.

No spectrum has been submitted ... add a spectrum!

Oligomerization Organism Molecular Weight Cofactor
? Clytia gregaria 26.4 kDa -

FPbase ID: ENFU4

Attributes

Ex λ Em λ EC (M-1 cm-1) QY Brightness pKa Maturation (min) Lifetime (ns)
485 500 63,030 0.86 54.21      
Edit States/Attributes

Photostability

No photostability measurements available ... add one!

cgreGFP Sequence

BLAST
MTTLTEGAKLFEKEIPYITELEGDVEGMKFIIKGVGTGDATTGTIKAKYICTTGDLPVPWATILSSLSYGVFCFAKYPRHIADFFKSTQPDGYSQDRIISFDNDGQYDVKAKVTYENGTLYNRVTVKGTGFKSNGNILGMRVLYHSPPHAVYILPDRKNGGMKIEYNKAFDVMGGGHQMARHAQFNKPLGAWEEDYPLYHHLTVWTSFGKDPDDDETDHLNIVEVIKAVDLETYR
GenBank: ADI71929
UniProtKB: D7PM06
IPG: 20272185

Excerpts

No excerpts have been added for cgreGFP
Excerpts are snippets from publications that capture key information about this protein that does not easily fit into one of the existing fields (such as a summary, motivation, or observation).

Primary Reference

Green-fluorescent protein from the bioluminescent jellyfish Clytia gregaria: cDNA cloning, expression, and characterization of novel recombinant protein

Markova Sv, Burakova Lp, Frank La, Golz S, Korostileva Ka, Vysotski Es

(2010). Photochemical & Photobiological Sciences, 9(6) , 757. doi: 10.1039/c0pp00023j. Article

Additional References

    No additional references have been added.

External Resources

Change history

Something missing or incorrect? Submit a change Submit a change